PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01008639001
Common NameLOC100268072, VIT_17s0000g00320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ARF
Protein Properties Length: 863aa    MW: 96132.2 Da    PI: 6.6401
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01008639001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.89.8e-24163264199
                        EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                        f+k+lt sd++++g +++ +++a+e+      +  ++ +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   +
  GSVIVT01008639001 163 FCKTLTASDTSTHGGFSVLRRHADEClpqldmS-RQPPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--R 251
                        99****************************963.3334459************************************************..4 PP

                        SSEE..EEEEE-S CS
                 B3  87 rsefelvvkvfrk 99 
                         +++el+v+v+r+
  GSVIVT01008639001 252 GENGELRVGVRRA 264
                        49999*****996 PP

2Auxin_resp1193.7e-39289371183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        a+ha st+++F+v+Y+Pr+s++eF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp rW++SkWr+Lk
  GSVIVT01008639001 289 AWHAKSTGTMFTVYYKPRTSPAEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPKRWRDSKWRCLK 371
                        79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.35E-40159292IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.7E-41160278IPR015300DNA-binding pseudobarrel domain
CDDcd100173.15E-21161263No hitNo description
SMARTSM010191.4E-22163265IPR003340B3 DNA binding domain
PROSITE profilePS5086312.012163265IPR003340B3 DNA binding domain
PfamPF023621.2E-21163264IPR003340B3 DNA binding domain
PfamPF065072.9E-36289371IPR010525Auxin response factor
PfamPF023093.1E-11728821IPR033389AUX/IAA domain
SuperFamilySSF542776.87E-12735813No hitNo description
PROSITE profilePS5174525.283736818IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 863 aa     Download sequence    Send to blast
MASSEVSIKG NCGHGRGESF TSGYSEPNDG GVSRSVAEGQ KGHSSVSGAG KDFETALYTE  60
LWHACAGPLV TVPRERERVF YFPQGHIEQV EASTNQVSDQ QMPVYDLPSK ILCRVINVQL  120
KAEPDTDEVF AQVTLLPEPN QDETAQEKEP LPPPPPRFHV HSFCKTLTAS DTSTHGGFSV  180
LRRHADECLP QLDMSRQPPT QELVAKDLHG NEWRFRHIFR GQPRRHLLQS GWSVFVSSKR  240
LVAGDAFIFL RGENGELRVG VRRAMRQQGN VPSSVISSHS MHLGVLATAW HAKSTGTMFT  300
VYYKPRTSPA EFIVPFDQYM ESVKNNYSIG MRFKMRFEGE EAPEQRFTGT IVGIEDADPK  360
RWRDSKWRCL KVRWDETSTI PRPDRVSPWK IEPAVTPPAL NPLPVPRPKR PRSNMVPSSP  420
DSSVLTREGS SKVTVDPSPA SGFSRVLQGQ EFSTLRGTFA ESNESDTAEK SVVWPPLLDD  480
EKIDVVSTSR RFGSDNWMHL VRHEPTCTDL LSGFGARTDS SHGFSSFVDQ NDVAANTMKK  540
HLEHESKFNL LAGPWSMMPS GLSLNLLESS IKVPVQGSDM PYQTRGDARF GGFSEYPTLH  600
GHRVELQQGN WLMPPPAQSH FENFAHSREL MPKPILVQKQ EAVKPKDGNC KLFGIPLIGN  660
PVISEPAMSY RSMTNEPAGH LHLAPSAFDS DQKSEQSKGA KSTDNPLAVS EQEKPCQTSL  720
PLSRDVQGKV QSVSTRSCTK VHKQGIALGR SVDLTKFNNY DELIAELDQL FEFGGELMAP  780
KKNWLIVYTD DEGDMMLVGD DPWQEFCGMV RKIYIYTREE VQRMNPGTLN SKNDDNPSVA  840
EGMDAKEVKR QPVPLTSNLE NC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1765039312354Auxin response factor 1
4ldw_A1e-1765039312354Auxin response factor 1
4ldw_B1e-1765039312354Auxin response factor 1
4ldx_A1e-1765039312354Auxin response factor 1
4ldx_B1e-1765039312354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.288440.0bud| fruit| inflorescence| leaf| stem
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4584730.0AM458473.1 Vitis vinifera contig VV78X094999.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284543.10.0PREDICTED: auxin response factor 2
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLD7SH690.0D7SH69_VITVI; Auxin response factor
STRINGVIT_17s0000g00320.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2